PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa02g076450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family SRS
Protein Properties Length: 339aa    MW: 36179.8 Da    PI: 8.0571
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa02g076450.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702236.93.2e-731182704154
          DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa..aeaaskrkrelkskkqsalsstklssaes 96 
                     g+ sCqdCGnqakkdC+h+RCRtCCksrg++C+thvkstWvpaakrrerqqqla+ ++ +++s+   e+ +kr+re+  +++++l +t+++s+++
  Csa02g076450.1 118 GGPSCQDCGNQAKKDCTHMRCRTCCKSRGLECSTHVKSTWVPAAKRRERQQQLASGQQPQSQSQpqVESVPKRQREHFPSRSNSLVCTRIPSNNT 212
                     6789***************************************************9999888877688999************************ PP

          DUF702  97 kkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                     ++ le+ s+P+evss+a+frcvrvssvdd+eee+aY+tavsigGhvfkGiLydqG++e
  Csa02g076450.1 213 SSGLEIGSFPPEVSSPAIFRCVRVSSVDDEEEEYAYKTAVSIGGHVFKGILYDQGPAE 270
                     *******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051426.4E-66119269IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.8E-27121163IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.4E-26221268IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MAGFFSLGQG GGRGNSQDHR TNNNPSPSGT ESWLWCRNPN SNANAGAGDV VAPSSYKGTL  60
ELWQHPNNQE IIFQQQQQQR LDLYTSAAGL GVGPSNRNLL ETSGGALMMM RNGSSSGGGP  120
SCQDCGNQAK KDCTHMRCRT CCKSRGLECS THVKSTWVPA AKRRERQQQL ASGQQPQSQS  180
QPQVESVPKR QREHFPSRSN SLVCTRIPSN NTSSGLEIGS FPPEVSSPAI FRCVRVSSVD  240
DEEEEYAYKT AVSIGGHVFK GILYDQGPAE RSSSGGGSQP LNLITAGPSA SSSSPNVSCN  300
DGVVGSNSDH YIDPASLSYP TPINTFMTGT HFFSNPRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010465641.10.0PREDICTED: protein SHORT INTERNODES-like isoform X2
SwissprotQ9XGX00.0SHI_ARATH; Protein SHORT INTERNODES
TrEMBLR0EWR70.0R0EWR7_9BRAS; Uncharacterized protein
STRINGAT5G66350.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.11e-163Lateral root primordium (LRP) protein-related